Call Now: +1 858 800 3101 Email: info@innopep.com


Your shopping cart is empty!

InnoPep Products Filter

Anti-Inflammatory Peptides


Show:
Sort By:
Dermcidin, DCD - 1L

SSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL

$125.00

LL - 37 fragment (8 - 37), LL - 8 - 37

KSKEKIGKEFKRIVQRIKDFLRNLVPRTES

$156.00

LL - 37, acetylated & amidated

Ac- LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-NH2

$206.00

Lactoferricin B, Lactoferrin (17 - 41)

FKCRRWQWRMKKLGAPSITCVRRAF (disulfide bridge:3-20)

$131.00

Human Lactotransferrin (37 - 61), Lactoferricin H

TKCFQWQRNMRKVRGPPVSCIKRDS (Disulfide between Cys3 and Cys20)

$153.00

Temporin A, amide

FLPLIGRVLSGIL-NH2

$71.00

Temporin L, amide

FVQWFSKFLGRIL-NH2

$72.00

Protegrine - 1 (PG - 1), amide

RGGRLCYCRRRFCVCVGR-NH2 (disulfide bridge:6-15 and 8-13)

$270.00

Bac2A; Bactenecin 2A

RLARIVVIRVAR-NH2

$63.00

NRC - 13 Pleurocidin

GWRTLLKKAEVKTVGKLALKHYL-NH2

$115.00

About InnoPep

InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.

Newsletter Signup

Stay Updated With Our Latest Products.

Your email is safe with us, we don't spam.