Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
Adrenomedullin (AM) (1-52), human
| Overview | |
|---|---|
| Description | Adrenomedullin (1-52) is a potent hypotensive peptide hormone with some structural similarity to calcitonin gene-related peptide. Adrenomedullin (1-52) has vasodilatory properties. |
| Cas No | 148498-78-6 |
| Sequence | {TYR}{ARG}{GLN}{SER}{MET}{ASN}{ASN}{PHE}{GLN}{GLY}{LEU}{ARG}{SER}{PHE}{GLY}{CYS}{ARG}{PHE}{GLY}{THR}{CYS}{THR}{VAL}{GLN}{LYS}{LEU}{ALA}{HIS}{GLN}{ILE}{TYR}{GLN}{PHE}{THR}{ASP}{LYS}{ASP}{LYS}{ASP}{ASN}{VAL}{ALA}{PRO}{ARG}{SER}{LYS}{ILE}{SER}{PRO}{GLN}{GLY}{TYR}-NH2 |
| Sequence Shortening | YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 |
| Molecular Formula | C264H406N80O77S3 |
| C Terminal | NH2 |
| Disulfide Bridge | Disulfide bridge: Cys16-Cys21 |
| Molecular Weight | 6028.9 |
| Properties | |
| Purity | > 95% |
| Format Bridge | 16-21 |
| Solubility | The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. |
| Gmp Flag | 0 |
| Storage | Before use, store the peptide in the DRY form at 0-5°C. For best and most repeatable results, rehydrate the peptide immediately before use. Do not re-freeze any unused portions. |
| Note | The peptide elicits a potent and long lasting hypotensive effect. Adrenomedullin (1-52), as supplied is intended for research use only, Do not use it to diagnose or treat any disease. |
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.