Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
Adrenomedullin (AM) (22-52), human
| Overview | |
|---|---|
| Description | Adrenomedullin (ADM) is a 52-aa hypotensive peptide. Adrenomedullin (ADM) has structural similarity with amylin. ADM is produced in peripheral tissues, adrenal medulla, lung, and kidney. ADM has specific receptors on astrocytes and it is unregulated in ischaemia. |
| Cas No | 159899-65-7 |
| Sequence | {THR}{VAL}{GLN}{LYS}{LEU}{ALA}{HIS}{GLN}{ILE}{TYR}{GLN}{PHE}{THR}{ASP}{LYS}{ASP}{LYS}{ASP}{ASN}{VAL}{ALA}{PRO}{ARG}{SER}{LYS}{ILE}{SER}{PRO}{GLN}{GLY}{TYR}-NH2 |
| Sequence Shortening | TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 |
| Molecular Formula | C159H252N46O48 |
| C Terminal | NH2 |
| Molecular Weight | 3576.1 |
| Properties | |
| Purity | > 95% |
| Solubility | Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. |
| Storage | Before using, store the peptide in the DRY form at - 20°C. For best and repeatable results, rehydrate the peptide immediately before using. Do not re-freeze any unused portions. |
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.