Call Now: +1 858 800 3101 Email: info@innopep.com


Your shopping cart is empty!

Amylin, feline

Product Code: N4173

Price: $238.00

Available Options

* Package Size:
- +
Overview
Synonyms IAPPDAP
Description Amylin is produced in the pancreas beta cells and coreleased with insulin. Amylin's amino acid sequence shows great homology with CGRP. Amylin has been shown to reverse insulin inhibition of hepatic gluconeogenesis and to inhibit muscle uptake of glucose.
Sequence {LYS}{CYS}{ASN}{THR}{ALA}{THR}{CYS}{ALA}{THR}{GLN}{ARG}{LEU}{ALA}{ASN}{PHE}{LEU}{ILE}{ARG}{SER}{SER}{ASN}{ASN}{LEU}{GLY}{ALA}{ILE}{LEU}{SER}{PRO}{THR}{ASN}{VAL}{GLY}{SER}{ASN}{THR}{TYR}-NH2
Sequence Shortening KCNTATCATQRLANFLIRSSNNLGAILSPTNVGSNTY-NH2
Molecular Formula C165H272N52O54S2
C Terminal NH2
Disulfide Bridge Cys2-Cys7
Molecular Weight 3912.42
Properties
Purity > 95%
Format Bridge 2-7
Solubility Insoluble in water. Dissolve peptide with 10% Acetonitrile in water.
Gmp Flag 0
Storage Lyophilized powder may be stored at 4°C for short-term only. Reconstitute to nominal volume by adding sterile 40-50% glycerol and store at -20°C. Reconstituted product is stable for 24 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Note This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

About InnoPep

InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.

Newsletter Signup

Stay Updated With Our Latest Products.

Your email is safe with us, we don't spam.