Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
Exendin (9-39)
| Overview | |
|---|---|
| Description | Exendin (9-39) is an inverse agonist of the murine glucagon-like peptide-1 receptor. There are implications for basal intracellular cyclic adenosine 3', 5'-monophosphate levels and beta-cell glucose competence. Exendin (9-39) is a competitive inhibitor of Exendin-3 and Exendin-4. On digestive smooth muscle, exendin (9-39) behaves as an antagonist for two members of the glucagon-receptor family, GLP-1 and glicentin. |
| Cas No | 133514-43-9 |
| Sequence | {ASP}{LEU}{SER}{LYS}{GLN}{MET}{GLU}{GLU}{GLU}{ALA}{VAL}{ARG}{LEU}{PHE}{ILE}{GLU}{TRP}{LEU}{LYS}{ASN}{GLY}{GLY}{PRO}{SER}{SER}{GLY}{ALA}{PRO}{PRO}{PRO}{SER}-NH2 |
| Sequence Shortening | DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
| Molecular Formula | C149H234N40O47S1 |
| C Terminal | NH2 |
| Molecular Weight | 3369.76 |
| Properties | |
| Purity | > 95% |
| Solubility | Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents. |
| Gmp Flag | 0 |
| Storage | Store the peptide at -20°C. |
| Note | Specific exendin receptor antagonist. |
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.