Call Now: +1 858 800 3101 Email: info@innopep.com


Your shopping cart is empty!

Glucagon-Like Peptide (GLP) I (7-37)

Product Code: N4149

Price: $119.00

Available Options

* Package Size:
- +
Overview
Synonyms Glucagon-Like PeptideI; Glucagon-Like Peptide 1; Glucagon-Like Peptide1; GLP-I; GLPI; GLP-1; GLP1; GCG peptide
Description GLP-1 (7-37) is a truncated, bioactive form of GLP-1 that is the product of proglucagon processing in intestinal endocrine L cells. It is a potent insulinotropic hormone.
Sequence {HIS}{ALA}{GLU}{GLY}{THR}{PHE}{THR}{SER}{ASP}{VAL}{SER}{SER}{TYR}{LEU}{GLU}{GLY}{GLN}{ALA}{ALA}{LYS}{GLU}{PHE}{ILE}{ALA}{TRP}{LEU}{VAL}{LYS}{GLY}{ARG}{GLY}
Sequence Shortening HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Molecular Formula C151H228N40O47
Molecular Weight 3355.68
Properties
Purity > 95%
Solubility Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
Gmp Flag 0
Storage Store at -20°C. Keep tightly closed. Store in a cool dry place.
Note Potent Insulin secretagogue.

About InnoPep

InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.

Newsletter Signup

Stay Updated With Our Latest Products.

Your email is safe with us, we don't spam.