Call Now: +1 858 800 3101 Email: info@innopep.com


Your shopping cart is empty!

Neuropeptide Y, human

Product Code: N4048

Price: $71.00

Available Options

* Package Size:
- +
Overview
Synonyms NPY
Description Neuropeptide Y (NPY) is a vasoconstrictor and a brain peptide that inhibits Ca2+-activated K+ channels in vascular smooth muscle. Neuropeptide Y (NPY) is implicated in the control of blood pressure, sexual behavior, and food intake. Neuropeptide Y (NPY) inhibits cholecystokinin- and secretin-stimulated pancreatic secretion.
Cas No 90880-35-6
Sequence {TYR}{PRO}{SER}{LYS}{PRO}{ASP}{ASN}{PRO}{GLY}{GLU}{ASP}{ALA}{PRO}{ALA}{GLU}{ASP}{MET}{ALA}{ARG}{TYR}{TYR}{SER}{ALA}{LEU}{ARG}{HIS}{TYR}{ILE}{ASN}{LEU}{ILE}{THR}{ARG}{GLN}{ARG}{TYR}-NH2
Sequence Shortening YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
Molecular Formula C189H285N55O57S1
C Terminal NH2
Molecular Weight 4271.68
Properties
Purity > 95%
Solubility Solvent: 1 mg/ml CH3COOH 0.05 M clear, colorless
Gmp Flag 0
Storage Store at -20°C.

About InnoPep

InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.

Newsletter Signup

Stay Updated With Our Latest Products.

Your email is safe with us, we don't spam.