Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
Neuropeptide Y, human
| Overview | |
|---|---|
| Synonyms | NPY |
| Description | Neuropeptide Y (NPY) is a vasoconstrictor and a brain peptide that inhibits Ca2+-activated K+ channels in vascular smooth muscle. Neuropeptide Y (NPY) is implicated in the control of blood pressure, sexual behavior, and food intake. Neuropeptide Y (NPY) inhibits cholecystokinin- and secretin-stimulated pancreatic secretion. |
| Cas No | 90880-35-6 |
| Sequence | {TYR}{PRO}{SER}{LYS}{PRO}{ASP}{ASN}{PRO}{GLY}{GLU}{ASP}{ALA}{PRO}{ALA}{GLU}{ASP}{MET}{ALA}{ARG}{TYR}{TYR}{SER}{ALA}{LEU}{ARG}{HIS}{TYR}{ILE}{ASN}{LEU}{ILE}{THR}{ARG}{GLN}{ARG}{TYR}-NH2 |
| Sequence Shortening | YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 |
| Molecular Formula | C189H285N55O57S1 |
| C Terminal | NH2 |
| Molecular Weight | 4271.68 |
| Properties | |
| Purity | > 95% |
| Solubility | Solvent: 1 mg/ml CH3COOH 0.05 M clear, colorless |
| Gmp Flag | 0 |
| Storage | Store at -20°C. |
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.