Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
Prolactin Releasing Peptide (1-31), human
| Overview | |
|---|---|
| Synonyms | PrRP |
| Description | GenScript Prolactin-releasing peptide is a specific prolactin releasing peptide. GenScript prolactin-releasing peptide (PrRP) was originally isolated as an endogenous hypothalamic ligand for the hGR3 orphan receptor and has been shown to release prolactin from dispersed pituitaries harvested from lactating female rats and only at very high doses in cycling females. PrRPs have no effect on prolactin production from dispersed pituitary cells harvested from males. |
| Sequence | {SER}{ARG}{THR}{HIS}{ARG}{HIS}{SER}{MET}{GLU}{ILE}{ARG}{THR}{PRO}{ASP}{ILE}{ASN}{PRO}{ALA}{TRP}{TYR}{ALA}{SER}{ARG}{GLY}{ILE}{ARG}{PRO}{VAL}{GLY}{ARG}{PHE}-NH2 |
| Sequence Shortening | SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2 |
| Molecular Formula | C160H252N56O42S1 |
| C Terminal | NH2 |
| Molecular Weight | 3664.15 |
| Properties | |
| Purity | > 95% |
| Solubility | Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents. |
| Gmp Flag | 0 |
| Storage | Store the peptide at -20°C. Keep container tightly closed. Store in a cool dry place. |
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.