Call Now: +1 858 800 3101 Email: info@innopep.com


Your shopping cart is empty!

InnoPep Products Filter

InnoPep LL - 37, Antimicrobial Peptide, human LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES.. Product #: 1215-005 Regular price: $115.00 $115.00

LL - 37, Antimicrobial Peptide, human

Product Code: 1215-005
Weight: 0.50mg

Price: $115.00

Available Options

* Package Size:

Antimicrobial peptide LL-37,  belonging  to the cathelicidin family,  is the first amphipathic alpha-helical peptide isolated from human.  It plays an important role in the first line of defense against local infection and systemic invasion of pathogens at sites of inflammation and wounds.  Cytotoxic to both bacterial and normal eukaryotic cells , LL-37 is significantly resistant to proteolytic degradation in solution. 

Dürr, UHN. et al. Biochim. Biophys. Acta 1758, 1408 (2006); Neville, F. et al. Biophys. J. 90, 1275 (2006); Oren, Z. et al. Biochem. J. 341, 501(1999).
Chemistry
Purity > 95% By HPLC
Molecular Weight 4493.3
Sequence LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Sequence (3 Letter) H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH
Biology
Storage Store at -20°C, cap vial tightly at all times.

About InnoPep

InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.

Newsletter Signup

Stay Updated With Our Latest Products.

Your email is safe with us, we don't spam.