Call Now: +1 858 800 3101 Email: info@innopep.com


Your shopping cart is empty!

InnoPep Products Filter

InnoPep LL - 37 pentamide LLGNFFRKSKQKIGKQFKRIVQRIKNFFRNLVPRTQS.. Product #: 1220-005 Regular price: $198.00 $198.00

LL - 37 pentamide

Product Code: 1220-005
Weight: 0.50mg

Price: $198.00

Available Options

* Package Size:

This synthetic peptide is a modification of the LL-37 cathelicidin peptide in which each aspartic acid of LL-37 is replaced by an asparagine, and glutamic acid by glutamine. The anti-staphylococcal activity LL-37 pentamide is greater than that of LL-37 because multiple acidic residues of human LL-37 reduce its efficacy against Staphylococci.

Zhao, C. et al. Antimicrob. Agents Chemother. 45, 2695 (2001).
Chemistry
Purity > 95% By HPLC
Molecular Weight 4522.4
Sequence LLGNFFRKSKQKIGKQFKRIVQRIKNFFRNLVPRTQS
Sequence (3 Letter) H-Leu-Leu-Gly-Asn-Phe-Phe-Arg-Lys-Ser-Lys-Gln-Lys-Ile-Gly-Lys-Gln-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asn-Phe-Phe-Arg-Asn-Leu-Val-Pro-Arg-Thr-Gln-Ser-OH
Biology
Storage Store at -20°C, cap vial tightly at all times.

About InnoPep

InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.

Newsletter Signup

Stay Updated With Our Latest Products.

Your email is safe with us, we don't spam.