Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
Ubiquitin (1 - 34)
| Overview | |
|---|---|
| Description | This peptide is amino acids 1 to 34 fragment of ubiquitin. The main function of ubiquitin is labeling proteins for proteasomal degradation. Ubiquitin, a 76-residue protein, is shown to have activity against fungal and bacterial pathogens. This N-terminal peptide is stopped at the fungal wall level, whereas C-terminal peptide (residues 65 €“76) is able to cross the cell wall and the plasma membrane of fungi and to accumulate in fungi. It was shown that these two peptides act synergistically to kill filamentous fungi. This N-terminal peptide could be used with C-terminal-derived peptide as a potent anti-fungal agent. |
| Sequence | MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKE |
| Sequence (3 Letter) | H-Met-Gln-Ile-Phe-Val-Lys-Thr-Leu-Thr-Gly-Lys-Thr-Ile-Thr-Leu-Glu-Val-Glu-Pro-Ser-Asp-Thr-Ile-Glu-Asn-Val-Lys-Ala-Lys-Ile-Gln-Asp-Lys-Glu-OH |
| Molecular Weight | 3848.5 |
| Properties | |
| Purity | > 95% By HPLC |
| Storage | Store at -20 °C, cap vial tightly at all times. |
Kieffer, A. et al. FASEB J. 10.1096/fj.02-0699fje (2003); Ozkaynak, E. et al. Nature 312, 663 (1984).
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.