Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
C34 - LC - Biotin, gp41 HIV fragment
| Overview | |
|---|---|
| Description | This peptide C34, also known as HR2, belongs to the helical region of gp41 of HIV, C-terminal heptad repeat 2 (HR2) defined as C helix or C-peptide. This peptide is biotinylated through 6-aminohexanoate (LC) as a spacer. HIV-1 enters cells by membrane fusion, gp41. C-peptides are potent inhibitors of HIV-1 fusion. |
| Sequence | WMEWDREINNYTSLIHSLIEESQNQQEKNEQELLK(LC-Biotin) |
| Sequence (3 Letter) | H-Trp-Met-Glu-Trp-Asp-Arg-Glu-Ile-Asn-Asn-Tyr-Thr-Ser-Leu-Ile-His-Ser-Leu-Ile-Glu-Glu-Ser-Gln-Asn-Gln-Gln-Glu-Lys-Asn-Glu-Gln-Glu-Leu-Leu-Lys(LC-BIOTIN)-NH2 |
| Molecular Weight | 4715.3 |
| Properties | |
| Purity | > 95% By HPLC |
| Storage | Store at -20 °C, cap vial tightly at all times. |
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.