Call Now: +1 858 800 3101 Email: info@innopep.com


Your shopping cart is empty!

Prostatic Acid Phosphatase (248 - 286), PAP (248 - 286)

Product Code: 1924-005

Price: $223.00

Available Options

* Package Size:
- +
Overview
Description Prostatic Acid Phosphatase (248-286), PAP (248-286) peptide is a semen-derived enhancer of viral infection (SEVI) factor found in semen. This peptide greatly increases HIV infection through enhanced virion attachment to target cells.
Sequence GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY
Sequence (3 Letter) H-Gly-Ile-His-Lys-Gln-Lys-Glu-Lys-Ser-Arg-Leu-Gln-Gly-Gly-Val-Leu-Val-Asn-Glu-Ile-Leu-Asn-His-Met-Lys-Arg-Ala-Thr-Gln-Ile-Pro-Ser-Tyr-Lys-Lys-Leu-Ile-Met-Tyr-OH
Molecular Weight 4551.5
Properties
Purity > 95% By HPLC
Storage Store at -20 °C, cap vial tightly at all times.

About InnoPep

InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.

Newsletter Signup

Stay Updated With Our Latest Products.

Your email is safe with us, we don't spam.