![Cys - LC - LL - 37<br>C - LC - [LL-37, 37 aa] Cys - LC - LL - 37<br>C - LC - [LL-37, 37 aa]](/media/com_eshop/products/resized/prod_150x150-230x230.png)
Call Now: +1 858 800 3101 Email: info@innopep.com
Overview | |
---|---|
Sequence | C-LC-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
Sequence (3 Letter) | H - Cys - LC - Leu - Leu - Gly - Asp - Phe - Phe - Arg - Lys - Ser - Lys - Glu - Lys - Ile - Gly - Lys - Glu - Phe - Lys - Arg - Ile - Val - Gln - Arg - Ile - Lys - Asp - Phe - Leu - Arg - Asn - Leu - Val - Pro - Arg - Thr - Glu - Ser - OH |
Molecular Weight | 4709.7 |
Properties | |
Purity | % Peak Area By HPLC ≥ 95% |
Storage | -20 °C |
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.