Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
LL - 37, scrambled
GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
| Overview | |
|---|---|
| Sequence | GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR |
| Sequence (3 Letter) | Gly - Leu - Lys - Leu - Arg - Phe - Glu - Phe - Ser - Lys - Ile - Lys - Gly - Glu - Phe - Leu - Lys - Thr - Pro - Glu - Val - Arg - Phe - Arg - Asp - Ile - Lys - Leu - Lys - Asp - Asn - Arg - Ile - Ser - Val - Gln - Arg |
| Molecular Weight | 4493.3 |
| Properties | |
| Purity | % Peak Area By HPLC ≥ 95% |
| Storage | -20 °C |
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.