Call Now: +1 858 800 3101 Email: info@innopep.com


Your shopping cart is empty!

InnoPep Products Filter

InnoPep LL - 37, scrambled
GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR.. Product #: 3182-0100 Regular price: $257.00 $257.00

LL - 37, scrambled
GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR

Product Code: 3182-0100
Weight: 1.00mg

Price: $257.00

Available Options

* Package Size:

Chemistry
Purity % Peak Area By HPLC ≥ 95%
Molecular Weight 4493.3
Sequence GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
Sequence (3 Letter) Gly - Leu - Lys - Leu - Arg - Phe - Glu - Phe - Ser - Lys - Ile - Lys - Gly - Glu - Phe - Leu - Lys - Thr - Pro - Glu - Val - Arg - Phe - Arg - Asp - Ile - Lys - Leu - Lys - Asp - Asn - Arg - Ile - Ser - Val - Gln - Arg
Biology
Storage -20°C

About InnoPep

InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.

Newsletter Signup

Stay Updated With Our Latest Products.

Your email is safe with us, we don't spam.