Call Now: +1 858 800 3101 Email: info@innopep.com
| Overview | |
|---|---|
| Description | This 32 amino acid peptide contains a 17 amino acid ring structure that is common to all natriuretic peptides. It is also called the brain natriuretic peptide (BNP) because it was first identified in porcine brain; however, the main source of this peptide is not the brain but the cardiac ventricle. This cardiac neurohormone is secreted from the ventricles in response to volume expansion and pressure overload. It has natriuretic and vasodilatory effects and suppresses the renin-angiotensin-aldosterone system. |
| Sequence | SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26) |
| Sequence (3 Letter) | H - Ser - Pro - Lys - Met - Val - Gln - Gly - Ser - Gly - Cys - Phe - Gly - Arg - Lys - Met - Asp - Arg - Ile - Ser - Ser - Ser - Ser - Gly - Leu - Gly - Cys - Lys - Val - Leu - Arg - Arg - His - OH (Disulfide bridge: 10 - 26) |
| Molecular Weight | 3464.1 |
| Properties | |
| Purity | % Peak Area By HPLC ≥ 95% |
| Storage | -20 °C |
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.