Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
Tat - Beclin - 1
YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT
| Overview | |
|---|---|
| Description | Beclin-1 peptide is the HIV-1 Nef binding portion of full-length human Beclin-1 protein (amino acids 267-299). Beclin-1 protein is an autophagy inducing agent that may trigger cellular adaptation, survival or cell death. When conjugated to the cell-permeable peptide, it can successfully enter cells and induce autophagy. RELATED PRODUCTS:Beclin-1, Cat# 65466Tat-Beclin-1, scrambled, Cat# 65468 |
| Sequence | YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT |
| Sequence (3 Letter) | Tyr - Gly - Arg - Lys - Lys - Arg - Arg - Gln - Arg - Arg - Arg - Gly - Gly - Thr - Asn - Val - Phe - Asn - Ala - Thr - Phe - Glu - Ile - Trp - His - Asp - Gly - Glu - Phe - Gly - Thr - OH |
| Molecular Weight | 3741.1 |
| Properties | |
| Purity | % Peak Area By HPLC ≥ 95% |
| Storage | -20 °C |
Shoji-Kawata, S. Nature 494, 201-209 (2013); Marquez, RT. Am J Cancer Res 2 (2), 214–221 (2012).
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.