Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
Corticotropin Releasing Factor, CRF, ovine
SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA - NH2
| Overview | |
|---|---|
| Sequence | SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2 |
| Sequence (3 Letter) | H - Ser - Gln - Glu - Pro - Pro - Ile - Ser - Leu - Asp - Leu - Thr - Phe - His - Leu - Leu - Arg - Glu - Val - Leu - Glu - Met - Thr - Lys - Ala - Asp - Gln - Leu - Ala - Gln - Gln - Ala - His - Ser - Asn - Arg - Lys - Leu - Leu - Asp - Ile - Ala - NH2 |
| Molecular Weight | 4670.4 |
| Properties | |
| Purity | % Peak Area By HPLC ≥ 95% |
| Storage | -20 °C |
Ref: Vale, W. et al. Science 213, 1394 (1981).
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.