Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
HNP - 1, Defensin Human Neutrophil Peptide - 1
ACYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge: 2 - 30, 4 - 19, 9 - 29)
| Overview | |
|---|---|
| Description | Mammalian defensins are abundant in the cytoplasmic azurophilic granules of neutrophils, Paneth cells of the small intestine and some macrophages. Human a-defensin-1 (HNP-1) is a peptide possessing both broad antimicrobial (both Gram-positive and Gram-negative bacteria) and cytotoxic activities. HNP-1 reduces adenoviral infection by more than 95%. |
| Sequence | ACYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge: 2-30, 4-19, 9-29) |
| Sequence (3 Letter) | H - Ala - Cys - Tyr - Cys - Arg - Ile - Pro - Ala - Cys - Ile - Ala - Gly - Glu - Arg - Arg - Tyr - Gly - Thr - Cys - Ile - Tyr - Gln - Gly - Arg - Leu - Trp - Ala - Phe - Cys - Cys - OH (Disulfide bridge: 2 - 30, 4 - 19, 9 - 29) |
| Molecular Weight | 3442.1 |
| Properties | |
| Purity | % Peak Area By HPLC ≥ 95% |
| Storage | -20 °C |
Ref: Frick, I. et al. J. Biol. Chem. 278, 16561 (2003); Valore, E. at al. J. Clin. Invest. 97, 1624 (1996); Mizukawa, N. et al. Anticancer Res. 20, 1125 (2000); Bastian, A. and H. Schafer, Regul Pept. 101, 157 (2001).
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.