![Exendin (9 - 39)<br>DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS - NH2 Exendin (9 - 39)<br>DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS - NH2](/media/com_eshop/products/resized/prod_150x150-230x230.png)
Call Now: +1 858 800 3101 Email: info@innopep.com
Overview | |
---|---|
Description | This truncated Exendin-4 peptide, Exendin (9-39) amide, is a potent Glucagon-Like Peptide 1 (GLP-1) receptor antagonist. Unlike the full length Exendin-4 (a GLP-1 agonist), Exendin (9-39) antagonizes GLP-1 €“stimulated insulin release after food intake. It is a competitive inhibitor of Exendin-3 and Exendin-4. |
Sequence | DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
Sequence (3 Letter) | H - Asp - Leu - Ser - Lys - Gln - Met - Glu - Glu - Glu - Ala - Val - Arg - Leu - Phe - Ile - Glu - Trp - Leu - Lys - Asn - Gly - Gly - Pro - Ser - Ser - Gly - Ala - Pro - Pro - Pro - Ser - NH2 |
Molecular Weight | 3369.8 |
Properties | |
Purity | % Peak Area By HPLC ≥ 95% |
Storage | -20 °C |
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.