Call Now: +1 858 800 3101 Email: info@innopep.com
Overview | |
---|---|
Description | This is a fluorescent (Alexa Fluor 555)-labeled ß-Amyloid peptide, Abs/Em=551/567 nm. Alexa Fluor 555 labeled Aß (1-40) is more photostable than Cy3 ®-labeled Aß (1-40). |
Sequence | Alexa Fluor 555-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
Sequence (3 Letter) | Alexa Fluor 555 - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val |
Molecular Weight | 5182.31 |
Properties | |
Purity | % Peak Area By HPLC ≥ 95% |
Storage | -20 °C |
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.