Call Now: +1 858 800 3101 Email: info@innopep.com


Your shopping cart is empty!
Product Code: 3209-0010

Price: $187.00

Available Options

* Package Size:
- +
Overview
Description This is a fluorescent (Alexa Fluor 555)-labeled ß-Amyloid peptide, Abs/Em=551/567 nm. Alexa Fluor 555 labeled Aß (1-40) is more photostable than Cy3 ®-labeled Aß (1-40).
Sequence Alexa Fluor 555-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence (3 Letter) Alexa Fluor 555 - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val
Molecular Weight 5182.31
Properties
Purity % Peak Area By HPLC ≥ 95%
Storage -20 °C

About InnoPep

InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.

Newsletter Signup

Stay Updated With Our Latest Products.

Your email is safe with us, we don't spam.