Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
Beta - Amyloid (11 - 42), Alexa Fluor 488 - labeled, Human
Alexa Fluor 488 - EVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
| Overview | |
|---|---|
| Description | This is amino acids 11 to 42 fragment of b-amyloid peptide labeled with Alexa Fluor 488, Abs/Em=503/528 nm. Post-mortem Alzheimer €™s diseased (AD) brain specimens reveal significant levels of this b -amyloid peptide within the insoluble amyloid pools. Alexa Fluor 488-labeled b-amyloid (11-42) has a brighter intensity than FITC or FAM-labeled b-amyloid (11-42). |
| Sequence | Alexa Fluor 488-EVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA |
| Sequence (3 Letter) | Alexa Fluor 488 - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - OH |
| Molecular Weight | 3692.3 |
| Properties | |
| Purity | % Peak Area By HPLC ≥ 95% |
| Storage | -20 °C |
Huse, J. T. et al. J. Biol. Chem. 277, 16278 (2002); Qahwash, I. et al. J. Biol. Chem. 279, 39010 (2004); Liu, K. et al. Biochem. 41, 3128 (2002).
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.