Call Now: +1 858 800 3101 Email: info@innopep.com


Your shopping cart is empty!

GIP, rat
YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNLTQ

Product Code: 3404-0100

Price: $308.00

Available Options

* Package Size:
- +
Overview
Sequence YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNLTQ
Sequence (3 Letter) Tyr - Ala - Glu - Gly - Thr - Phe - Ile - Ser - Asp - Tyr - Ser - Ile - Ala - Met - Asp - Lys - Ile - Arg - Gln - Gln - Asp - Phe - Val - Asn - Trp - Leu - Leu - Ala - Gln - Lys - Gly - Lys - Lys - Asn - Asp - Trp - Lys - His - Asn - Leu - Thr - Gln - OH
Molecular Weight 5002.95
Properties
Purity % Peak Area By HPLC ≥ 95%
Storage -20 °C

About InnoPep

InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.

Newsletter Signup

Stay Updated With Our Latest Products.

Your email is safe with us, we don't spam.