Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
GLP - 1(9 - 36), amide, human
| Overview | |
|---|---|
| Description | This peptide is residues 9-36 of glucagon-like peptide 1 (GLP-1). GLP-1 is a neuroendocrine hormone derived from preproglucagon secreted by intestinal L cells. GLP-1 stimulates glucose-dependent insulin secretion and inhibits glucagon secretion. |
| Sequence | EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| Sequence (3 Letter) | H-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 |
| Molecular Weight | 3089.5 |
| Properties | |
| Purity | > 95% By HPLC |
| Storage | Store at -20 °C, cap vial tightly at all times. |
John, H. et a. Eur J Med Res 13, 73 (2008).
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.