Call Now: +1 858 800 3101 Email: info@innopep.com
Overview | |
---|---|
Description | This is a fluorescent (FAM)-labeled Glucagon peptide, Abs/Em=494/521 nm. |
Sequence | FAM-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT |
Sequence (3 Letter) | FAM-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-OH |
Molecular Weight | 3841.1 |
Properties | |
Purity | > 95% By HPLC |
Storage | Store at -20 °C, cap vial tightly at all times. |
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.