Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
Glucagon - Like Peptide 1, GLP - 1 amide, human
| Overview | |
|---|---|
| Description | This peptide, formed by cleavage of two basic residues, is an endogenous peptide secreted into the circulation by intestinal L cells. A potent glucose-dependent insulinotropic hormone, it has important actions on gastric motility, on the suppression of plasma glucagon levels and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. It potentiates insulin secretion by pancreatic A-cells in a glucose-dependent manner and inhibits gastric emptying and acid secretion. |
| Sequence | HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| Sequence (3 Letter) | H-His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 |
| Molecular Weight | 4111.5 |
| Properties | |
| Purity | > 95% By HPLC |
| Storage | Store at -20 °C, cap vial tightly at all times. |
Ref: Drucker, D. et al. Proc. Natl. Acad. Sci. USA 84, 3434 (1987); Kieffer, T. and J. Habener, Endo. Rev. 20, 876 (1999).
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.