Call Now: +1 858 800 3101 Email: info@innopep.com
Overview | |
---|---|
Description | Neuropeptide F (NPF), found in Drosophila is a homolog of the mammalian Neuropeptide Y. |
Sequence | PDKDFIVNPSDLVLDNKAALRDYLRQINEYFAIIGRPRF-NH2 |
Sequence (3 Letter) | H-Pro-Asp-Lys-Asp-Phe-Ile-Val-Asn-Pro-Ser-Asp-Leu-Val-Leu-Asp-Asn-Lys-Ala-Ala-Leu-Arg-Asp-Tyr-Leu-Arg-Gln-Ile-Asn-Glu-Tyr-Phe-Ala-Ile-Ile-Gly-Arg-Pro-Arg-Phe-NH2 |
Molecular Weight | 4593.3 |
Properties | |
Purity | > 95% By HPLC |
Storage | Store at -20 °C, cap vial tightly at all times. |
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.