Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
Neuropeptide F
| Overview | |
|---|---|
| Description | Neuropeptide F (NPF), found in Drosophila is a homolog of the mammalian Neuropeptide Y. |
| Sequence | PDKDFIVNPSDLVLDNKAALRDYLRQINEYFAIIGRPRF-NH2 |
| Sequence (3 Letter) | H-Pro-Asp-Lys-Asp-Phe-Ile-Val-Asn-Pro-Ser-Asp-Leu-Val-Leu-Asp-Asn-Lys-Ala-Ala-Leu-Arg-Asp-Tyr-Leu-Arg-Gln-Ile-Asn-Glu-Tyr-Phe-Ala-Ile-Ile-Gly-Arg-Pro-Arg-Phe-NH2 |
| Molecular Weight | 4593.3 |
| Properties | |
| Purity | > 95% By HPLC |
| Storage | Store at -20 °C, cap vial tightly at all times. |
Ref: Wen, T. et al. Proc. Natl. Acad. Sci. USA 102, 2141 (2005).
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.