Call Now: +1 858 800 3101 Email: info@innopep.com


Your shopping cart is empty!
Product Code: 1606-005

Price: $160.00

Available Options

* Package Size:
- +
Overview
Description This neuropeptide isolated from bovine hypothalmus is more active than Vasoactive Intestinal Peptide (VIP) in stimulating adenylate cyclase EC50=7nM.
Sequence HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
Sequence (3 Letter) H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2
Molecular Weight 4534.3
Properties
Purity > 95% By HPLC
Storage Store at -20 °C, cap vial tightly at all times.
Ref: Miyata, A. et al. BBRC 173, 1271 (1990).

About InnoPep

InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.

Newsletter Signup

Stay Updated With Our Latest Products.

Your email is safe with us, we don't spam.