Call Now: +1 858 800 3101 Email: info@innopep.com
| Overview | |
|---|---|
| Description | PYY (3-36), a Y2R agonist, is released from the gastrointestinal tract postprandially in proportion to the calorie content of a meal and can inhibit food intake. It has been shown that peripheral injection of PYY (3-36) in rats inhibited food intake and reduced weight gain. In addition, infusion of PYY (3-36) in humans significantly decreased appetite and reduced food intake. Thus, the PYY (3-36) may represent a lead compound for the development of drugs for the treatment of obesity. |
| Sequence | IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 |
| Sequence (3 Letter) | H-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 |
| Molecular Weight | 4049.5 |
| Properties | |
| Purity | > 95% By HPLC |
| Storage | Store at -20 °C, cap vial tightly at all times. |
Ref: Grandt, D. et al. Regul. Peptides 40, 161 (1992); Batterham, R. et al. Nature. 418, 650 (2002).
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.