Call Now: +1 858 800 3101 Email: info@innopep.com
| Overview | |
|---|---|
| Description | A hybrid peptide of neurotensin and VIP consisting of N-terminal Lys-Pro-Arg-Arg-Pro-Tyr folllowed by 7 -28 residues VIP. |
| Sequence | KPRRPYTDNYTRLRKQMAVKKYLNSILN-NH2 |
| Sequence (3 Letter) | H-Lys-Pro-Arg-Arg-Pro-Tyr-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2 |
| Molecular Weight | 3467.1 |
| Properties | |
| Purity | > 95% By HPLC |
| Storage | Store at -20 °C, cap vial tightly at all times. |
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.