Call Now: +1 858 800 3101 Email: info@innopep.com
| Overview | |
|---|---|
| Description | This synthetic peptide mimics wild-type AH (amphipathic helix) and inhibits membrane association of NS5A, hence impairing HCV replication. |
| Sequence | SGSWLRDVWDWICTVLTDFKTWLQSKLDYKD-NH2 |
| Sequence (3 Letter) | Ser - Gly - Ser - Trp - Leu - Arg - Asp - Val - Trp - Asp - Trp - Ile - Cys - Thr - Val - Leu - Thr - Asp - Phe - Lys - Thr - Trp - Leu - Gln - Ser - Lys - Leu - Asp - Tyr - Lys - Asp - NH2 |
| Molecular Weight | 3805.3 |
| Properties | |
| Purity | % Peak Area By HPLC ≥ 95% |
| Storage | -20 °C |
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.