Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
Ryanodine receptor 1 (RyR1) (3614 - 3643); Calmodulin Binding Peptide (CaMBP)
KSKKAVWHKLLSKQRRRAVVACFRMTPLYN
| Overview | |
|---|---|
| Description | This peptide is amino acids 3614 to 3643 fragment of Ryanodine receptor 1 (RyR1), also known as calmodulin binding peptide (CaMBP), belonging to a class of intracellular calcium channels. It is the major cellular mediator of calcium-induced calcium release (CICR) in animal cells. The ryanodine receptor is itself activated by cytosolic calcium. |
| Sequence | KSKKAVWHKLLSKQRRRAVVACFRMTPLYN |
| Sequence (3 Letter) | H - Lys - Ser - Lys - Lys - Ala - Val - Trp - His - Lys - Leu - Leu - Ser - Lys - Gln - Arg - Arg - Arg - Ala - Val - Val - Ala - Cys - Phe - Arg - Met - Thr - Pro - Leu - Tyr - Asn - OH |
| Molecular Weight | 3616.4 |
| Properties | |
| Purity | % Peak Area By HPLC ≥ 95% |
| Storage | -20 °C |
Kovaks, E. et al. J Biol Chem 285, 1799 (2010).
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.