Call Now: +1 858 800 3101 Email: info@innopep.com
| Overview | |
|---|---|
| Description | This is amino acids 721 to 770 fragment of the amyloid precursor protein resulting from the g-secretase cleavage of the C-terminus of beta-amyloid precursor protein (APP) at Leu720-Val721. This peptide is also known as CTF50-99. The mutation at Leu723 (L723P) causes familial Alzheimer €™s disease. |
| Sequence | VMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN |
| Sequence (3 Letter) | H-Val-Met-Leu-Lys-Lys-Lys-Gln-Tyr-Thr-Ser-Ile-His-His-Gly-Val-Val-Glu-Val-Asp-Ala-Ala-Val-Thr-Pro-Glu-Glu-Arg-His-Leu-Ser-Lys-Met-Gln-Gln-Asn-Gly-Tyr-Glu-Asn-Pro-Thr-Tyr-Lys-Phe-Phe-Glu-Gln-Met-Gln-Asn-OH |
| Molecular Weight | 5910.7 |
| Properties | |
| Purity | > 95% By HPLC |
| Storage | Store at -20 °C, cap vial tightly at all times. |
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.