Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
Beta - Amyloid (1 - 40)
| Overview | |
|---|---|
| Description | Aß (1-40) together with Aß (1-42) are two major C-terminal variants of the Aß protein constituting the majority of Aßs. These undergo post-secretory aggregation and deposition in the Alzheimer €™s disease brain. Electron microscopy of b-amyloid (1-40) stained with Thioflavin T (data generated by an AnaSpec scientist). |
| Sequence | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
| Sequence (3 Letter) | H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH |
| Molecular Weight | 4329.9 |
| Properties | |
| Purity | > 95% By HPLC |
| Storage | Store at -20 °C, cap vial tightly at all times. |
Ref: Masters, CL. et al. Proc. Natl. Acad. Sci. USA 82, 4245 (1985); Yankner, BA. Neuron 16, 921 (1996); Geula, C. et al. Nat. Med. 4, 827 (1998); Shin, R. et al. J. Neurosci.17, 8187 (1997).
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.