Call Now: +1 858 800 3101 Email: info@innopep.com
| Overview | |
|---|---|
| Description | The difference between this recently released and the previous product (Cat# 23515) is the change at the C terminus from a carboxylic acid to an amide. The biological activity should remain the same. |
| Sequence | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin)-NH2 |
| Sequence (3 Letter) | H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Lys(Biotin)-NH2 |
| Molecular Weight | 4683.4 |
| Properties | |
| Purity | > 95% By HPLC |
| Storage | Store at -20 °C, cap vial tightly at all times. |
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.