Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
Beta - Amyloid (8 - 40), mouse, rat
| Overview | |
|---|---|
| Description | This is amino acids 8 to 40 fragment of mouse and rat beta-amyloid. It differs from human beta-amyloid by two amino acid residues: Tyr10 and His13 residues in human beta-amyloid correspond to Phe10, and Arg13 in mice and rat sequence. |
| Sequence | SGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV |
| Sequence (3 Letter) | H-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH |
| Molecular Weight | 3462 |
| Properties | |
| Purity | > 95% By HPLC |
| Storage | Store at -20 °C, cap vial tightly at all times. |
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.