![Des - gamma - carboxylated Osteocalcin/Bone Gla Protein<br>YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV (Disulfide bridge:C23 - 29) Des - gamma - carboxylated Osteocalcin/Bone Gla Protein<br>YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV (Disulfide bridge:C23 - 29)](/media/com_eshop/products/resized/prod_150x150-230x230.png)
Call Now: +1 858 800 3101 Email: info@innopep.com
Overview | |
---|---|
Description | This peptide is des-gamma-carboxylated osteocalcin/bone Gla protein (BGP). Osteocalcin/BGP is the most abundant non-collagenous protein of the bone extracellular matrix and is secreted by osteoblasts. This des-gamma-carboxylated peptide serves as a substrate for vitamin K-dependent carboxylase, which modifies Glu17, Glu21, and Glu24 to Gla residues. |
Sequence | YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV (Disulfide bridge:C23-29) |
Sequence (3 Letter) | H - Tyr - Leu - Tyr - Gln - Trp - Leu - Gly - Ala - Pro - Val - Pro - Tyr - Pro - Asp - Pro - Leu - Glu - Pro - Arg - Arg - Glu - Val - Cys - Glu - Leu - Asn - Pro - Asp - Cys - Asp - Glu - Leu - Ala - Asp - His - Ile - Gly - Phe - Gln - Glu - Ala - Tyr - |
Molecular Weight | 5797.5 |
Properties | |
Purity | % Peak Area By HPLC ≥ 95% |
Storage | -20 °C |
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.