Call Now: +1 858 800 3101 Email: info@innopep.com


Your shopping cart is empty!

Parathyroid Hormone (1 - 34), human
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

Product Code: 3362-0100

Price: $150.00

Available Options

* Package Size:
- +
Overview
Description Parathyroid hormone (PTH) regulates the metabolism of calcium and phosphate. PTH and PTH-related polypeptide (PTHrP) play important roles in calcium homeostasis of bone, kidney, breast, and placenta; they signal via the PTH/PTHrP and PTH2 receptors. PTH(1 €“34) administration suppresses cardiovascular calcification and down-regulates aortic osteogenic programs driven by diabetes and dyslipidemia.
Sequence SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Sequence (3 Letter) H - Ser - Val - Ser - Glu - Ile - Gln - Leu - Met - His - Asn - Leu - Gly - Lys - His - Leu - Asn - Ser - Met - Glu - Arg - Val - Glu - Trp - Leu - Arg - Lys - Lys - Leu - Gln - Asp - Val - His - Asn - Phe - OH
Molecular Weight 4117.8
Properties
Purity % Peak Area By HPLC ≥ 95%
Storage -20 °C
Ref: Shao, J. et al. J. Biol. Chem. 278, 50195 (2003); Shew, RL. and PKT. Pang Peptides 5, 485 (1984).

About InnoPep

InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.

Newsletter Signup

Stay Updated With Our Latest Products.

Your email is safe with us, we don't spam.