Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
PDKtide
KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC
| Overview | |
|---|---|
| Description | This peptide is a substrate for PDK1 (Phosphatidylinositide-Dependent Kinase 1). |
| Sequence | KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC |
| Sequence (3 Letter) | H - Lys - Thr - Phe - Cys - Gly - Thr - Pro - Glu - Tyr - Leu - Ala - Pro - Glu - Val - Arg - Arg - Glu - Pro - Arg - Ile - Leu - Ser - Glu - Glu - Glu - Gln - Glu - Met - Phe - Arg - Asp - Phe - Asp - Tyr - Ile - Ala - Asp - Trp - Cys - OH |
| Molecular Weight | 4771.4 |
| Properties | |
| Purity | % Peak Area By HPLC ≥ 95% |
| Storage | -20 °C |
Biondi, R.M. et al. EMBO J. 19, 979 (2000).; Komander, D. et al. Structure 12, 215 (2004).
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.