Call Now: +1 858 800 3101 Email: info@innopep.com


Your shopping cart is empty!

InnoPep Products Filter

InnoPep 3 x Hemagglutinin (HA) Tag MEYPYDVPDYAAEYPYDVPDYAAEYPYDVPDYAAKLE.. Product #: 2030-005 Regular price: $228.00 $228.00

3 x Hemagglutinin (HA) Tag

Product Code: 2030-005
Weight: 0.50mg

Price: $228.00

Available Options

* Package Size:

This tag peptide may be used to detect proteins and peptides, and to facilitate functional analysis of proteins of interest.

Kang, Y. et al. J. Biol. Chem. 281, 19019 (2006).
Chemistry
Purity > 95% By HPLC
Molecular Weight 4372.7
Sequence MEYPYDVPDYAAEYPYDVPDYAAEYPYDVPDYAAKLE
Sequence (3 Letter) H-Met-Glu-Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala-Ala-Glu-Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala-Ala-Glu-Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala-Ala-Lys-Leu-Glu-OH
Biology
Storage Store at -20°C, cap vial tightly at all times.

About InnoPep

InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.

Newsletter Signup

Stay Updated With Our Latest Products.

Your email is safe with us, we don't spam.