Call Now: +1 858 800 3101 Email: info@innopep.com


Your shopping cart is empty!
Product Code: 3386-0100

Price: $68.00

Available Options

* Package Size:
- +
Overview
Description TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer €™s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat (3R) or four repeat (R4) domains, in addition to the presence or absence of one or two insert domains at the amino-terminus (see figure below). Tau Peptide (337-368) is a 32-amino acid long peptide derived from the Repeat 4 domain. RELATED PRODUCTS:Tau Peptide (45-73) (Exon 2/Insert 1 domain)Tau Peptide (74-102) (Exon 3/Insert 2 domain)Tau Peptide (244-274) (Repeat 1 domain) Tau Peptide (275-305) (Repeat 2 domain)Tau Peptide (306-336) (Repeat 3 domain)
Sequence VEVKSEKLDFKDRVQSKIGSLDNITHVPGGGN
Sequence (3 Letter) Val - Glu - Val - Lys - Ser - Glu - Lys - Leu - Asp - Phe - Lys - Asp - Arg - Val - Gln - Ser - Lys - Ile - Gly - Ser - Leu - Asp - Asn - Ile - Thr - His - Val - Pro - Gly - Gly - Gly - Asn - OH
Molecular Weight 3467.86
Properties
Purity % Peak Area By HPLC ≥ 95%
Storage -20 °C
Buee, L. et al. Brain Res Rev 33 95 (2000).
Trinczek, B. et al. Mol Biol Cell 6, 1887 (1995).

About InnoPep

InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.

Newsletter Signup

Stay Updated With Our Latest Products.

Your email is safe with us, we don't spam.