Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
Iberiotoxin (IbTX)
Pyr - FTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ(Disulfide bridge: 7 - 28, 13 - 33, 17 - 35)
| Overview | |
|---|---|
| Description | A 37-amino acid peptide from the scorpion, Buthus tamulus, having 68% homology with charybdotoxin. It is a selective inhibitor of the highly conductance calcium-activated (maxi-K) potassium channels. |
| Sequence | Pyr-FTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ(Disulfide bridge: 7-28,13-33,17-35) |
| Sequence (3 Letter) | Pyr - Phe - Thr - Asp - Val - Asp - Cys - Ser - Val - Ser - Lys - Glu - Cys - Trp - Ser - Val - Cys - Lys - Asp - Leu - Phe - Gly - Val - Asp - Arg - Gly - Lys - Cys - Met - Gly - Lys - Lys - Cys - Arg - Cys - Tyr - Gln - OH (Disulfide: 7-28,13-33,17-35) |
| Molecular Weight | 4230.9 |
| Properties | |
| Purity | % Peak Area By HPLC ≥ 95% |
| Storage | -20 °C |
Galvez, A. et al. J. Biol. Chem. 265, 11083 (1990). Candia, S. et al. Biophys. J. 63, 583 (1992).
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.