Call Now: +1 858 800 3101 Email: info@innopep.com
| Overview | |
|---|---|
| Description | Calcitonin is hypocalcemic hormone produced by the parafollicular C cells of the thyroid or by the ultimobranchial bodies of nonmammalian vertebrates. Calcitonin decreases blood calcium and phosphate due to inhibition of resorption by osteoblasts and osteocytes. | 
| Cas No | 57014-02-5 | 
| Sequence | {CYS}{SER}{ASN}{LEU}{SER}{THR}{CYS}{VAL}{LEU}{GLY}{LYS}{LEU}{SER}{GLN}{GLU}{LEU}{HIS}{LYS}{LEU}{GLN}{THR}{TYR}{PRO}{ARG}{THR}{ASP}{VAL}{GLY}{ALA}{GLY}{THR}{PRO}-NH2 | 
| Sequence Shortening | CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2 | 
| Molecular Formula | C146H241N43O47S2 | 
| C Terminal | NH2 | 
| Disulfide Bridge | Disulfide bridge: Cys1-Cys7 | 
| Molecular Weight | 3414.9 | 
| Properties | |
| Purity | > 95% | 
| Format Bridge | 1-7 | 
| Storage | Store at -20°C. Keep tightly closed. Store in a cool dry place. | 
| Note | Calcitonin is A 32 amino acid polypeptide, 8 of which are conserved across all species. | 
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.