Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
Corticotropin Releasing Factor, human, rat
| Overview | |
|---|---|
| Synonyms | CRF, human, ratCorticotropin-releasing hormone (CRH) |
| Description | Corticotropin-releasing factor (CRF) has been widely implicated as playing a major role in modulating the endocrine, autonomic, behavioral and immune responses to stress. Corticotropin Releasing Factor (CRF) is a hypothalamic peptide that releases adrenocorticotropic hormone (ACTH) and endorphin from the anterior pituitary. Corticotropin Releasing Factor (CRF) is also a neurotransmitter in the central nervous system, and is involved in autonomic and endocrine responses to stress. |
| Cas No | 86784-80-7 |
| Sequence | {SER}{GLU}{GLU}{PRO}{PRO}{ILE}{SER}{LEU}{ASP}{LEU}{THR}{PHE}{HIS}{LEU}{LEU}{ARG}{GLU}{VAL}{LEU}{GLU}{MET}{ALA}{ARG}{ALA}{GLU}{GLN}{LEU}{ALA}{GLN}{GLN}{ALA}{HIS}{SER}{ASN}{ARG}{LYS}{LEU}{MET}{GLU}{ILE}{ILE}-NH2 |
| Sequence Shortening | SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2 |
| Molecular Formula | C208H344N60O63S2 |
| C Terminal | NH2 |
| Molecular Weight | 4757.45 |
| Properties | |
| Purity | > 95% |
| Solubility | Soluble in water (1 mg/ml), clear and colorless |
| Gmp Flag | 0 |
| Storage | Store at -20°C |
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.