Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
Corticotropin Releasing Factor, ovine
| Overview | |
|---|---|
| Synonyms | CRFCorticotropin-releasing hormone (CRH) |
| Description | Corticotropin Releasing Factor (CRF) is a hypothalamic peptide that releases ACTH and endorphin from the anterior pituitary. Corticotropin Releasing Factor is also a neurotransitter in the central nervous system, and is involved in autonomic and endocrine responses to stress. |
| Cas No | 9015-71-8 |
| Sequence | {SER}{GLN}{GLU}{PRO}{PRO}{ILE}{SER}{LEU}{ASP}{LEU}{THR}{PHE}{HIS}{LEU}{LEU}{ARG}{GLU}{VAL}{LEU}{GLU}{MET}{THR}{LYS}{ALA}{ASP}{GLN}{LEU}{ALA}{GLN}{GLN}{ALA}{HIS}{SER}{ASN}{ARG}{LYS}{LEU}{LEU}{ASP}{ILE}{ALA}-NH2 |
| Sequence Shortening | SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2 |
| Molecular Formula | C205H339N59O63S1 |
| C Terminal | NH2 |
| Molecular Weight | 4670.31 |
| Properties | |
| Purity | > 95% |
| Solubility | Insoluble in water. Dissolve peptide in 60% Acetonitrile with 0.1% TFA solution followed by water or desired buffer. |
| Gmp Flag | 0 |
| Storage | Store at -20°C. Keep tightly closed. Store with desiccant. |
| Note | Corticotropin Releasing Factor (CRF) analog used to prepare iodinated CRF for receptor studies and immunoassay. |
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.