Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
Peptide YY (PYY) (3-36), human
| Overview | |
|---|---|
| Description | Peptide YY (PYY), a novel 36 amino-acid amidated hormone is a component of the complex neuroendocrine control process. This gut hormone (3-36), when infused into subjects, has been shown to reduce food intake in normal-weight and obese individuals. PYY (3-36) infusion also reduces the plasma levels of the hunger-promoting hormone ghrelin. PYY (3-36) levels have been shown to drop pre-meal and then increase post-prandially. In circulation, PYY (3-36) exists in at least two molecular forms: (1-36) and (3-36). PYY (3-36) selectively binds to Y2 receptors, and it has been found in human intestine and circulating blood. |
| Cas No | 126339-09-1 |
| Sequence | {ILE}{LYS}{PRO}{GLU}{ALA}{PRO}{GLY}{GLU}{ASP}{ALA}{SER}{PRO}{GLU}{GLU}{LEU}{ASN}{ARG}{TYR}{TYR}{ALA}{SER}{LEU}{ARG}{HIS}{TYR}{LEU} {ASN}{LEU}{VAL}{THR}{ARG}{GLN}{ARG}{TYR}-NH2 |
| Sequence Shortening | IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 |
| Molecular Formula | C180H279N53O54 |
| C Terminal | NH2 |
| Molecular Weight | 4049.48 |
| Properties | |
| Purity | > 95% |
| Solubility | The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents. |
| Gmp Flag | 0 |
| Storage | Store the peptide at -20°C. |
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.