Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
Peptide YY (PYY), human
| Overview | |
|---|---|
| Synonyms | PYY |
| Description | Peptide YY (PYY) is mainly found in gastrointestinal tract. It is believed to involve feeding behavior. It is a gut hormone that inhibits both secretin- and cholecystokinin-stimulated pancreatic secretion. This peptide is an endogenous nonselective agonist at NPY receptors. |
| Cas No | 118997-30-1 |
| Sequence | {TYR}{PRO}{ILE}{LYS}{PRO}{GLU}{ALA}{PRO}{GLY}{GLU}{ASP}{ALA}{SER}{PRO}{GLU}{GLU}{LEU}{ASN}{ARG}{TYR}{TYR}{ALA}{SER}{LEU}{ARG}{HIS}{TYR}{LEU}{ASN}{LEU}{VAL}{THR}{ARG}{GLN}{ARG}{TYR}-NH2 |
| Sequence Shortening | YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 |
| Molecular Formula | C194H295N55O57 |
| C Terminal | NH2 |
| Molecular Weight | 4309.75 |
| Properties | |
| Purity | > 95% |
| Gmp Flag | 0 |
| Storage | Store the peptide at -20°C. Keep container tightly closed. |
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.