Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
VIP, human, ovine, porcine, rat
| Overview | |
|---|---|
| Description | Peptide VIP is a Neuropeptide that is widely distributed in the central and peripheral nervous systems; Peptide VIP is a vasodilator, bronchodilator and smooth muscle relaxant. Peptide VIP modulates the activity of many immune system cell types. VIP is a mitogen for embryonic sympathetic neurons and its neuroprotective actions are mediated by the release of activity-dependent neurotrophic factors from glial cells. |
| Cas No | 40077-57-4 |
| Sequence | {HIS}{SER}{ASP}{ALA}{VAL}{PHE}{THR}{ASP}{ASN}{TYR}{THR}{ARG}{LEU}{ARG}{LYS}{GLN}{MET}{ALA}{VAL}{LYS}{LYS}{TYR}{LEU}{ASN}{SER}{ILE}{LEU}{ASN}-NH2 |
| Sequence Shortening | HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 |
| Molecular Formula | C147H238N44O42S |
| C Terminal | NH2 |
| Molecular Weight | 3325.8 |
| Properties | |
| Purity | > 95% |
| Solubility | Soluble in water (1 mg/ml), colorless |
| Gmp Flag | 0 |
| Storage | Store at -20°C. Keep tightly closed. |
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.