![VIP, human, ovine, porcine, rat VIP, human, ovine, porcine, rat](/media/com_eshop/products/resized/prod_150x150-230x230.png)
Call Now: +1 858 800 3101 Email: info@innopep.com
Overview | |
---|---|
Description | Peptide VIP is a Neuropeptide that is widely distributed in the central and peripheral nervous systems; Peptide VIP is a vasodilator, bronchodilator and smooth muscle relaxant. Peptide VIP modulates the activity of many immune system cell types. VIP is a mitogen for embryonic sympathetic neurons and its neuroprotective actions are mediated by the release of activity-dependent neurotrophic factors from glial cells. |
Cas No | 40077-57-4 |
Sequence | {HIS}{SER}{ASP}{ALA}{VAL}{PHE}{THR}{ASP}{ASN}{TYR}{THR}{ARG}{LEU}{ARG}{LYS}{GLN}{MET}{ALA}{VAL}{LYS}{LYS}{TYR}{LEU}{ASN}{SER}{ILE}{LEU}{ASN}-NH2 |
Sequence Shortening | HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 |
Molecular Formula | C147H238N44O42S |
C Terminal | NH2 |
Molecular Weight | 3325.8 |
Properties | |
Purity | > 95% |
Solubility | Soluble in water (1 mg/ml), colorless |
Gmp Flag | 0 |
Storage | Store at -20°C. Keep tightly closed. |
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.