Call Now: +1 858 800 3101 Email: info@innopep.com


Your shopping cart is empty!

VIP, human, ovine, porcine, rat

Product Code: N4004

Price: $62.00

Available Options

* Package Size:
- +
Overview
Description Peptide VIP is a Neuropeptide that is widely distributed in the central and peripheral nervous systems; Peptide VIP is a vasodilator, bronchodilator and smooth muscle relaxant. Peptide VIP modulates the activity of many immune system cell types. VIP is a mitogen for embryonic sympathetic neurons and its neuroprotective actions are mediated by the release of activity-dependent neurotrophic factors from glial cells.
Cas No 40077-57-4
Sequence {HIS}{SER}{ASP}{ALA}{VAL}{PHE}{THR}{ASP}{ASN}{TYR}{THR}{ARG}{LEU}{ARG}{LYS}{GLN}{MET}{ALA}{VAL}{LYS}{LYS}{TYR}{LEU}{ASN}{SER}{ILE}{LEU}{ASN}-NH2
Sequence Shortening HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
Molecular Formula C147H238N44O42S
C Terminal NH2
Molecular Weight 3325.8
Properties
Purity > 95%
Solubility Soluble in water (1 mg/ml), colorless
Gmp Flag 0
Storage Store at -20°C. Keep tightly closed.

About InnoPep

InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.

Newsletter Signup

Stay Updated With Our Latest Products.

Your email is safe with us, we don't spam.