Call Now: +1 858 800 3101 Email: info@innopep.com


Your shopping cart is empty!

New Products


Show:
Sort By:
[Gln8]-C517 (LH-RH), chicken

{pGLU}{HIS}{TRP}{SER}{TYR}{GLY}{LEU}{GLN}{PRO}{GLY}

$24.00

Leucokinin VIII

GASFYSWG-NH2

$24.00

Leptin (22-56), human

VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQK

$142.00

Growth Hormone Releasing Factor (GHRF) (1-44), human

YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2

$142.00

Growth Hormone Releasing Factor (GHRF)-2

d-ALA-D-2-NAL-ALA-TRP-d-PHE-LYS-NH2

$24.00

Glucagon (1-29), Human

HSQGTFTSDYSKYLDSRRAQDFVQWLMNT

$90.00

Glucagon-Like Peptide (GLP) I (7-36), amide, human

HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2

$90.00

Ghrelin, rat

GSS(n-Octanoyl)FLSPEHQKAQQRKESKKPPAKLQPR

$190.00

Gastrin-Releasing Peptide, human

VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2

$90.00

Galantide

GWTLNSAGYLLGPQQFFGLM-NH2

$71.00

Galanin Receptor Ligand M35

GWTLNSAGYLLGPPPGFSPFR-NH2

$71.00

About InnoPep

InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.

Newsletter Signup

Stay Updated With Our Latest Products.

Your email is safe with us, we don't spam.