![Cecropin A Cecropin A](/media/com_eshop/products/resized/prod_150x150-230x230.png)
Call Now: +1 858 800 3101 Email: info@innopep.com
Overview | |
---|---|
Description | Cecropin A is a naturally occurring, linear, cationic, 37-residue antimicrobial peptide. Cecropin A kills bacteria by dissipating transmembrane electrochemical ion-gradients. |
Sequence | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2 |
Sequence (3 Letter) | H-Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2 |
Molecular Weight | 4003.8 |
Properties | |
Purity | > 95% By HPLC |
Storage | Store at -20 °C, cap vial tightly at all times. |
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.