Call Now: +1 858 800 3101 Email: info@innopep.com


Your shopping cart is empty!

InnoPep Products Filter

InnoPep Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2.. Product #: 1207-005 Regular price: $157.00 $157.00

Cecropin A

Product Code: 1207-005
Weight: 0.50mg

Price: $157.00

Available Options

* Package Size:

Cecropin A is a naturally occurring, linear, cationic, 37-residue antimicrobial peptide. Cecropin A kills bacteria by dissipating transmembrane electrochemical ion-gradients.

Ref: Silvestro, L. et al. Biophysical J. 72, A195 (1997); Andreu, D. et al. Proc. Natl. Acad. Sci. USA 80, 6475 (1983); Silvestro, L. et al. Biochem. 36, 11452 (1997).
Chemistry
Purity > 95% By HPLC
Molecular Weight 4003.8
Sequence KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2
Sequence (3 Letter) H-Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2
Biology
Storage Store at -20°C, cap vial tightly at all times.

About InnoPep

InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.

Newsletter Signup

Stay Updated With Our Latest Products.

Your email is safe with us, we don't spam.